A Sketch Grammar of the Bafut Language by Pius Tamanji PDF

By Pius Tamanji

Show description

Read or Download A Sketch Grammar of the Bafut Language PDF

Similar linguistics books

New PDF release: Metaphor and Cognition: An Interactionist Approach (Studies

Many metaphors transcend pionting to the prevailing similarities among items -- they bring the similarities. Such metaphors, which were relegated to the again seat in lots of the cognitive technology learn, are the focal point of cognizance during this examine, which addresses the construction of similarity inside of an elaborately laid out interactive framework of cognition.

Download e-book for kindle: Researching Language and the Law: Textual Features and by

This quantity displays the most recent paintings of students specialising within the linguistic and felony features of normative texts throughout languages (English, Danish, French, Italian, Spanish) and legislations platforms. Like different domain names of specialized language use, criminal discourse is topic to the converging pressures of internationalisation and of rising practices that destabilise well-established norms and exercises.

Read e-book online Absolute Clauses in English from the Systemic Functional PDF

​This publication specializes in the structural range, semantic variability, case selection, stylistic features and diachronic distribution of English absolute clauses. The syntactic roles assumed via absolute clauses within the conventional feel will be categorised into clausal adjuncts, attendant conditions and appositives.

Additional resources for A Sketch Grammar of the Bafut Language

Sample text

5," it P2 fall ground on ³,WIHOORQWKHJURXQG´ d. 5," they P2 fall+Ext. on 9-ground ³7KH\IHOO VHYHUDOO\ RQWKHJURXQG´ ,QWKHH[DPSOHVLQ E DQG G WKHYHUE³IDOO´LVLQIOHFWHGWRLQGLFDWHWKDWWKHHYHQWDFWLRQRI falling affected several subjects at the same time. More will be said about such inflections in chapter 6. In (a) and (c), I have doubled the vowel o in the verb in order to accommodate an extra boundary low tone in the citation form and the low tone of the following desyllabified QDVDO RQ ³JURXQG´ In all the examples, the preposition deletes because of the preceding vowel.

D. Ü-lÆ1 mk-l¯¶¯ "the act/manner of) tapping palm wine/palm wine tapping" from %Â1Ä$ ³WDSpalm ZLQH´ (iii) Personal nouns a. b. c. d. " ³VODXJKWHU´ The derived nominals presented in these examples in (8) pattern in two noun classes. The examples in (8) (i) and (ii) belong in class 9 while those in (iii) belong in class 1, the normal class for humans and names of different professions/trades. The formation of the plurals of the personal nouns in (iii) provides reason to think that the relation between the verb stem and the following noun is possessive and not objective.

7KH H[SUHVVLRQ ³SURQRXQ´ DV XVHG LQ WKLs chapter refers to those forms that are in themselves complete words and which can stand instead of a noun, or which may be used in apposition to a noun, either before it or after it. However, since in most cases, these same elements can co-occur with a noun within the noun phrase as determiners, the discussion will also include their roles as modifiers. These different classes of pronouns are presented in the sections that follow. 1. A bsolute pronouns The absolute pronoun is one whose main function is to stand for a noun in a clause.

Download PDF sample

A Sketch Grammar of the Bafut Language by Pius Tamanji


by Edward
4.5

Rated 4.03 of 5 – based on 47 votes